MPG Peptide - middle region
MPG Peptide - middle region
Product Specifications
UniProt
P23571
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: VETEAYLGPEDEAAHSRGGRQTPRNRGMFMKPGTLYVYLIYGMYFCLNVS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
K4248304 1.0 µg DNA
Olfr1272 sgRNA CRISPR Lentivector (Mouse) (Target 3)
Sign In for Pricing
View Details 
MR222681L3V 200 µL
Adra1a (NM_013461) Mouse Tagged ORF Clone Lentiviral Particle
Sign In for Pricing
View Details 
MBS9004002 Inquire
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) PDC1 Polyclonal Antibody
Sign In for Pricing
View Details 311212-01 50 µg
Coagulation factor II, cleaved (R327) (F2, Prothrombin, Thrombin APII)
Sign In for Pricing
View Details 311212-02 100 µg
Coagulation factor II, cleaved (R327) (F2, Prothrombin, Thrombin APII)
Sign In for Pricing
View Details