CCR1 Peptide - middle region
CCR1 Peptide - middle region
Product Specifications
Product Name Alternative
Cmkbr1, Mip-1a-R
UniProt
P51675
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_034042.3
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: MQHRRLQSMTSIYLFNLAVSDLVFLFTLPFWIDYKLKDDWIFGDAMCKLL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
PRKAA2-7084M 50 µg
Recombinant Mouse PRKAA2 Protein, His (Fc)-Avi-tagged
Sign In for Pricing
View Details 
MBS2004327-01 0.1 mL
Biotin-Linked Antibody to Apolipoprotein M (APOM)
Sign In for Pricing
View Details MBS2004327-02 0.2 mL
Biotin-Linked Antibody to Apolipoprotein M (APOM)
Sign In for Pricing
View Details MBS2004327-03 0.5 mL
Biotin-Linked Antibody to Apolipoprotein M (APOM)
Sign In for Pricing
View Details