Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GSTM1 Peptide - middle region

GSTM1 Peptide - middle region

Product Specifications

Product Name Alternative

Gstb1, Gstb-1

UniProt

P10649

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_034488.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LEYTDSSYDEKRYTMGDAPDFDRSQWLNEKFKLGLDFPNLPYLIDGSHKI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pure Succinyl Canavalia ensiformis Lectin (Jackbean) -Succinyl Con A-
L-1102-25 50 mg

Pure Succinyl Canavalia ensiformis Lectin (Jackbean) -Succinyl Con A-

Sign In for Pricing
View Details
HER-4 / ERBB4 (HFR-1), CF568 conjugate, 0.1mg/mL
BNC682379-100 1x 100 µL

HER-4 / ERBB4 (HFR-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PPP1R3G (NM_001145115) Human Recombinant Protein
TP327133M 100 µg

PPP1R3G (NM_001145115) Human Recombinant Protein

Sign In for Pricing
View Details
OR52N1 (NM_001001913) Human Over-expression Lysate
LY424266 100 µg

OR52N1 (NM_001001913) Human Over-expression Lysate

Sign In for Pricing
View Details
INPP5D Polyclonal Antibody
E-AB-70200-01 60 µL

INPP5D Polyclonal Antibody

Sign In for Pricing
View Details
INPP5D Polyclonal Antibody
E-AB-70200-02 120 µL

INPP5D Polyclonal Antibody

Sign In for Pricing
View Details