Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GSTM1 Peptide - middle region

GSTM1 Peptide - middle region

Product Specifications

Product Name Alternative

Gstb1, Gstb-1

UniProt

P10649

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_034488.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LEYTDSSYDEKRYTMGDAPDFDRSQWLNEKFKLGLDFPNLPYLIDGSHKI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Casp4 activation kit by CRISPRa
GA200534 1 Kit

Mouse Casp4 activation kit by CRISPRa

Sign In for Pricing
View Details
CD72 (B Cell Marker) (BU40), CF740 conjugate, 0.1mg/mL
BNC742906-100 1x 100 µL

CD72 (B Cell Marker) (BU40), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
4,4,5,5,6,6,7,7,8,8,9,9,10,10,11,11,11-Heptadecafluoroundecanoic Acid
TRC-H265040-250MG 250 mg

4,4,5,5,6,6,7,7,8,8,9,9,10,10,11,11,11-Heptadecafluoroundecanoic Acid

Sign In for Pricing
View Details
Annexin A1 / (Hairy Cell Leukemia Marker) (ANXA1/1671), CF647 conjugate, 0.1mg/mL
BNC471671-500 1x 500 µL

Annexin A1 / (Hairy Cell Leukemia Marker) (ANXA1/1671), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
N-(2,4-Dichlorophenyl)urea
TRC-D437573-500MG 500 mg

N-(2,4-Dichlorophenyl)urea

Sign In for Pricing
View Details
SPSB2 Human Gene Knockout Kit (CRISPR)
KN400801 1 Kit

SPSB2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details