Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PC Peptide - middle region

PC Peptide - middle region

Product Specifications

Product Name Alternative

Pcx

UniProt

P52873

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_036876

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EAAISYTGDVADPSRTKYSLEYYMGLAEELVRAGTHILCIKDMAGLLKPA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ENTPD5 Knockout Hela Polyclonal Cells
ARG7637 1 Million

ENTPD5 Knockout Hela Polyclonal Cells

Sign In for Pricing
View Details
Ovalbumins
E5767-1g 1 g

Ovalbumins

Sign In for Pricing
View Details
SARS-CoV-2 Spike P681H Antibody [7C11H11] (Omicron, Alpha Variant)
PM-9375-002mg 0.02 mg

SARS-CoV-2 Spike P681H Antibody [7C11H11] (Omicron, Alpha Variant)

Sign In for Pricing
View Details
FCER1A Rabbit Polyclonal Antibody (BF350)
orb2382877 100 µL

FCER1A Rabbit Polyclonal Antibody (BF350)

Sign In for Pricing
View Details
SLC25A38 Antibody
DF14037-01 100 µL

SLC25A38 Antibody

Sign In for Pricing
View Details
SLC25A38 Antibody
DF14037-02 200 µL

SLC25A38 Antibody

Sign In for Pricing
View Details