Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PC Peptide - middle region

PC Peptide - middle region

Product Specifications

Product Name Alternative

Pcx

UniProt

P52873

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_036876

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EAAISYTGDVADPSRTKYSLEYYMGLAEELVRAGTHILCIKDMAGLLKPA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPIN3 Antibody
CSB-PA708489LA01HU-01 50 µg

SPIN3 Antibody

Sign In for Pricing
View Details
SPIN3 Antibody
CSB-PA708489LA01HU-02 100 µg

SPIN3 Antibody

Sign In for Pricing
View Details
SNAP23 Antibody (C-term) Blocking Peptide
MBS9220923-01 0.5 mg

SNAP23 Antibody (C-term) Blocking Peptide

Sign In for Pricing
View Details
SNAP23 Antibody (C-term) Blocking Peptide
MBS9220923-02 5x 0.5 mg

SNAP23 Antibody (C-term) Blocking Peptide

Sign In for Pricing
View Details
MeV H Polyclonal Antibody, FITC Conjugated
bs-42169R-FITC 100 µL

MeV H Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
Apolipoprotein A-IV (APOA4, MGC142154, MGC142156)
A2299-36H 100 µg

Apolipoprotein A-IV (APOA4, MGC142154, MGC142156)

Sign In for Pricing
View Details