CASP3 Peptide - middle region
CASP3 Peptide - middle region
Product Specifications
Product Name Alternative
CPP32, SCA-1, CPP32B
UniProt
P42574
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_004337.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: AYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVAT
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
PC5-30077U-01 25 µg
PE-Cy5 Mouse IgG2a, κ Isotype Control (C1.18.4)
Sign In for Pricing
View Details PC5-30077U-02 100 µg
PE-Cy5 Mouse IgG2a, κ Isotype Control (C1.18.4)
Sign In for Pricing
View Details RC228079L3V 200 µL
CRCP (NM_001142414) Human Tagged ORF Clone Lentiviral Particle
Sign In for Pricing
View Details