CASP3 Peptide - middle region
CASP3 Peptide - middle region
Product Specifications
Product Name Alternative
CPP32, SCA-1, CPP32B
UniProt
P42574
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_004337.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: AYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVAT
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
023454-01 48 Tests
Anti-Acetylcholine Receptor Antibody (Anti-AChR) BioAssayTM ELISA Kit (Human) (Discontiued) discontinued
Sign In for Pricing
View Details 023454-02 96 Tests
Anti-Acetylcholine Receptor Antibody (Anti-AChR) BioAssayTM ELISA Kit (Human) (Discontiued) discontinued
Sign In for Pricing
View Details 
39501141 1x 10^6 Cells / 1.0 mL
RHBG CRISPR Knock Out 293T Cell Line (Human)
Sign In for Pricing
View Details