Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KLF4 Peptide - N-terminal region

KLF4 Peptide - N-terminal region

Product Specifications

Product Name Alternative

EZF, GKLF

UniProt

O43474

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001300981.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EKTLRQAGAPNNRWREELSHMKRLPPVLPGRPYDLAAATVATDLESGGAG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NFkB-Luc (RFP) Lentivirus
LVP967-R 1 x 10^7 IFU/mL - 200 µL

NFkB-Luc (RFP) Lentivirus

Sign In for Pricing
View Details
Gapdh sgRNA CRISPR Lentivector (Mouse) (Target 3)
K5024404 1.0 µg DNA

Gapdh sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Gefapixant Impurity 9
RM-G223009-01 10 mg

Gefapixant Impurity 9

Sign In for Pricing
View Details
Gefapixant Impurity 9
RM-G223009-02 25 mg

Gefapixant Impurity 9

Sign In for Pricing
View Details
Gefapixant Impurity 9
RM-G223009-03 50 mg

Gefapixant Impurity 9

Sign In for Pricing
View Details
Gefapixant Impurity 9
RM-G223009-04 100 mg

Gefapixant Impurity 9

Sign In for Pricing
View Details