Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KLF4 Peptide - N-terminal region

KLF4 Peptide - N-terminal region

Product Specifications

Product Name Alternative

EZF, GKLF

UniProt

O43474

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001300981.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EKTLRQAGAPNNRWREELSHMKRLPPVLPGRPYDLAAATVATDLESGGAG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MPI-0479605
B3706-1 1 mg

MPI-0479605

Sign In for Pricing
View Details
Rabbit Polyclonal CCDC61 Antibody
NBP2-92014-0.02mL 0.02 mL

Rabbit Polyclonal CCDC61 Antibody

Sign In for Pricing
View Details
Caveolin-2 Recombinant Antibody, AbBy Fluor™ 405 Conjugated
bsm-61101R-BF405-01 20 µL

Caveolin-2 Recombinant Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
Caveolin-2 Recombinant Antibody, AbBy Fluor™ 405 Conjugated
bsm-61101R-BF405-02 100 µL

Caveolin-2 Recombinant Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
MAP2K4 Antibody
MBS9405864-01 0.05 mL

MAP2K4 Antibody

Sign In for Pricing
View Details
MAP2K4 Antibody
MBS9405864-02 0.1 mL

MAP2K4 Antibody

Sign In for Pricing
View Details