Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SIRT1 Peptide - middle region

SIRT1 Peptide - middle region

Product Specifications

Product Name Alternative

SIR2, SIR2L1, SIR2alpha

UniProt

Q96EB6

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001135970.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VSEDSSSPERTSPPDSSVIVTLLDQAAKSNDDLDVSESKGCMEEKPQEVQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TAK1 (MAP3K7) Human Gene Knockout Kit (CRISPR)
KN204454RB 1 Kit

TAK1 (MAP3K7) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
BDNF (NM_001143805) Human Over-expression Lysate
LC428351 20 µg

BDNF (NM_001143805) Human Over-expression Lysate

Sign In for Pricing
View Details
MKRN1 Goat Polyclonal Antibody
AP31559PU-N 100 µg

MKRN1 Goat Polyclonal Antibody

Sign In for Pricing
View Details
4-Phenylsulfonylaniline
TRC-P336790-250MG 250 mg

4-Phenylsulfonylaniline

Sign In for Pricing
View Details
EASYStep Pro Bovine Progesterone (Pg) ELISA Kit
RDEp-Pg-b 96 Tests

EASYStep Pro Bovine Progesterone (Pg) ELISA Kit

Sign In for Pricing
View Details
Beta Amyloid 1-42 Antibody
KC-526-01 50 μL

Beta Amyloid 1-42 Antibody

Sign In for Pricing
View Details