Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SIRT1 Peptide - middle region

SIRT1 Peptide - middle region

Product Specifications

Product Name Alternative

SIR2, SIR2L1, SIR2alpha

UniProt

Q96EB6

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001135970.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VSEDSSSPERTSPPDSSVIVTLLDQAAKSNDDLDVSESKGCMEEKPQEVQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Colon
CS626749 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
IL-13 receptor alpha 2 Recombinant Rabbit Monoclonal Antibody [PSH03-85]
HA722051 100 µL

IL-13 receptor alpha 2 Recombinant Rabbit Monoclonal Antibody [PSH03-85]

Sign In for Pricing
View Details
Bcl-2 Antibody
F42666-0.08ML 0.08 mL

Bcl-2 Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Ovary
CS710389 5x 5 µm

Tissue FFPE Sections, Ovary

Sign In for Pricing
View Details
SAR131675
TRC-S139510-500MG 500 mg

SAR131675

Sign In for Pricing
View Details
Psmc1 Mouse Gene Knockout Kit (CRISPR)
KN514108 1 Kit

Psmc1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details