What is the catalog number for XBP1 Peptide - middle region?

The catalog number for XBP1 Peptide - middle region is orb1997895.

What sizes are available for XBP1 Peptide - middle region?

XBP1 Peptide - middle region is available in the following size(s): 100 µg.

Is XBP1 Peptide - middle region in stock?

XBP1 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

XBP1 Peptide - middle region

Product Specifications

Product Name Alternative

TREB5, XBP-1, TREB-5, D11Ertd39e

UniProt

Q9R1S4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001258659.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TSWTLSCFSNVLPQSLLVWRNSQRSTQKDLVPYQPPFLCQWGPHQPSWKP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

30229036 100 µg

MMGT1 Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing

View Details

492614 100 µL

SPAG6 (Sperm Associated Antigen 6)

Sign In for Pricing

View Details

K6891905 3x 1.0 µg

Cryab sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing

View Details

E1560Hu-01 48 Well

Human Leptin receptor, LEPR ELISA KIT

Sign In for Pricing

View Details

E1560Hu-02 96 Well

Human Leptin receptor, LEPR ELISA KIT

Sign In for Pricing

View Details

E1560Hu-03 5x 96 Tests

Human Leptin receptor, LEPR ELISA KIT

Sign In for Pricing

View Details