XBP1 Peptide - middle region
XBP1 Peptide - middle region
Product Specifications
Product Name Alternative
TREB5, XBP-1, TREB-5, D11Ertd39e
UniProt
Q9R1S4
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001258659.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: TSWTLSCFSNVLPQSLLVWRNSQRSTQKDLVPYQPPFLCQWGPHQPSWKP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
orb2596704 100 µg
Histidine decarboxylase/HDC Rabbit Polyclonal Antibody (Biotin)
Sign In for Pricing
View Details 
LV691592 1.0 µg DNA
PTER Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
Sign In for Pricing
View Details 31240116 3x 1.0 µg
Myh8 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
Sign In for Pricing
View Details