Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BACH1 Peptide - middle region

BACH1 Peptide - middle region

Product Specifications

Product Name Alternative

BACH-1, BTBD24

UniProt

O14867

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001177.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EPQQEPCPYACVISLGDDSETDTEGDSESCSAREQECEVKLPFNAQRIIS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Smad4 Recombinant Rabbit monoclonal Antibody
HA750070 100 µL

Smad4 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
ZnAF-1
TRC-Z701533-50MG 50 mg

ZnAF-1

Sign In for Pricing
View Details
4-Nitroquinoline N-Oxide
TRC-N900715-250MG 250 mg

4-Nitroquinoline N-Oxide

Sign In for Pricing
View Details
Pxt1 (NM_153390) Mouse Tagged ORF Clone
MG200016 10 µg

Pxt1 (NM_153390) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Frozen Tissue Blocks, Breast
CB516260 1 Block

Frozen Tissue Blocks, Breast

Sign In for Pricing
View Details
Human ZBTB8B activation kit by CRISPRa
GA118910 1 Kit

Human ZBTB8B activation kit by CRISPRa

Sign In for Pricing
View Details