Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BACH1 Peptide - middle region

BACH1 Peptide - middle region

Product Specifications

Product Name Alternative

BACH-1, BTBD24

UniProt

O14867

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001177.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EPQQEPCPYACVISLGDDSETDTEGDSESCSAREQECEVKLPFNAQRIIS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vmn2r75 Mouse Gene Knockout Kit (CRISPR)
KN519206 1 Kit

Vmn2r75 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
NRF1 (NRF1/2608), CF740 conjugate, 0.1mg/mL
BNC742608-500 1x 500 µL

NRF1 (NRF1/2608), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Sumo 1 (SUMO1) Mouse Monoclonal Antibody [Clone ID: SPM571]
AM50183PU-T 20 µg

Sumo 1 (SUMO1) Mouse Monoclonal Antibody [Clone ID: SPM571]

Sign In for Pricing
View Details
Benzalkonium Chloride
TRC-B183553-500MG 500 mg

Benzalkonium Chloride

Sign In for Pricing
View Details
Human C2orf42 activation kit by CRISPRa
GA110424 1 Kit

Human C2orf42 activation kit by CRISPRa

Sign In for Pricing
View Details
CIB1 (1-191) Mouse Monoclonal Antibody [Clone ID: 1D1]
AM03117PU-S 50 µL

CIB1 (1-191) Mouse Monoclonal Antibody [Clone ID: 1D1]

Sign In for Pricing
View Details