Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COX1 Peptide - C-terminal region

COX1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

COI, MTCO1

UniProt

P00395

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

YP_003024028.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SLTAVMLMIFMIWEAFASKRKVLMVEEPSMNLEWLYGCPPPYHTFEEPVY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mal-amido-peg6-NHS
TRC-M111053-10MG 10 mg

Mal-amido-peg6-NHS

Sign In for Pricing
View Details
L-Aminobutyric Acid-d3
TRC-A602932-5MG 5 mg

L-Aminobutyric Acid-d3

Sign In for Pricing
View Details
PMEPA1 / TMEPAI (Tumor Suppressor Oncoprotein) (PMEPA1/2697), CF640R conjugate, 0.1mg/mL
BNC402697-500 1x 500 µL

PMEPA1 / TMEPAI (Tumor Suppressor Oncoprotein) (PMEPA1/2697), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CES2 (Center) Rabbit Polyclonal Antibody
AP50867PU-N 400 µL

CES2 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cytochrome P450 1A2 (CYP1A2) (NM_000761) Human Recombinant Protein
TP321636 20 µg

Cytochrome P450 1A2 (CYP1A2) (NM_000761) Human Recombinant Protein

Sign In for Pricing
View Details
IKBKG Antibody
KC-12689-01 50 μL

IKBKG Antibody

Sign In for Pricing
View Details