Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COX1 Peptide - C-terminal region

COX1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

COI, MTCO1

UniProt

P00395

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

YP_003024028.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SLTAVMLMIFMIWEAFASKRKVLMVEEPSMNLEWLYGCPPPYHTFEEPVY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ANKHD1-EIF4EBP3 activation kit by CRISPRa
GA118392 1 Kit

Human ANKHD1-EIF4EBP3 activation kit by CRISPRa

Sign In for Pricing
View Details
EEF1G (NM_001404) Human Over-expression Lysate
LY419955 100 µg

EEF1G (NM_001404) Human Over-expression Lysate

Sign In for Pricing
View Details
TG003
SIH-515-25MG 25 mg

TG003

Sign In for Pricing
View Details
Anti-SUMO Tag Antibody
KC-9668-01 50 μL

Anti-SUMO Tag Antibody

Sign In for Pricing
View Details
Anti-SUMO Tag Antibody
KC-9668-02 100 µL

Anti-SUMO Tag Antibody

Sign In for Pricing
View Details
Anti-SUMO Tag Antibody
KC-9668-03 1 mL

Anti-SUMO Tag Antibody

Sign In for Pricing
View Details