EFNA3 Peptide - C-terminal region
EFNA3 Peptide - C-terminal region
Product Specifications
Product Name Alternative
EFL2, EPLG3, LERK3, Ehk1-L
UniProt
P52797
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_004943.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: FTMGPNVKINVLEDFEGENPQVPKLEKSISGTSPKREHLPLAVGIAFFLM
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
E-EL-R0415 96 Tests
ELISA kit for Rat GATA5 (GATA Binding Protein 5)
Sign In for Pricing
View Details TL506309V 500 µL Each
D130040H23Rik Mouse shRNA Lentiviral Particle (Locus ID 211135)
Sign In for Pricing
View Details 
bs-8422R-APC-Cy5.5 100 µL
BOLA2 Polyclonal Antibody, APC-Cy5.5 Conjugated
Sign In for Pricing
View Details 