Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EFNA3 Peptide - C-terminal region

EFNA3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

EFL2, EPLG3, LERK3, Ehk1-L

UniProt

P52797

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_004943.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FTMGPNVKINVLEDFEGENPQVPKLEKSISGTSPKREHLPLAVGIAFFLM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DNAM-1 CRISPR Activation Plasmid (h)
sc-402189-ACT 20 µg

DNAM-1 CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
Rad54l2 3'UTR Luciferase Stable Cell Line
TU117481 1.0 mL

Rad54l2 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
(2E) -2-[1-[2-Cyclopropyl-1- (2-fluorophenyl) -2-oxoethyl]-4-hydroxy-3-piperidinylidene]acetic Acid Ethyl Ester (Mixture of Diastereomers)
160157 10 mg

(2E) -2-[1-[2-Cyclopropyl-1- (2-fluorophenyl) -2-oxoethyl]-4-hydroxy-3-piperidinylidene]acetic Acid Ethyl Ester (Mixture of Diastereomers)

Sign In for Pricing
View Details
MRP3 (ABCC3) Human qPCR Primer Pair (NM_003786)
HP207241 200 Reactions

MRP3 (ABCC3) Human qPCR Primer Pair (NM_003786)

Sign In for Pricing
View Details
Myosin Ic CRISPR Activation Plasmid (h2)
sc-403013-ACT-2 20 µg

Myosin Ic CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details
MSL3L2 Antibody
26-579 100 µL

MSL3L2 Antibody

Sign In for Pricing
View Details