Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PACS1 Peptide - C-terminal region

PACS1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MRD17

UniProt

Q6VY07

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_060496.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LQVDYWLGHPGERRREGDKRDASSKNTLKSVFRSVQVSRLPHSGEAQLSG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-COX-2 Antibody
orb1675159 0.1 mL

Anti-COX-2 Antibody

Sign In for Pricing
View Details
Perfluorophenyl 3- (2- (2- (4-formylbenzamido) ethoxy) ethoxy) propanoate
PC510230 1 Each

Perfluorophenyl 3- (2- (2- (4-formylbenzamido) ethoxy) ethoxy) propanoate

Sign In for Pricing
View Details
Chicken Osteocalcin ELISA Kit
MBS1603402-01 48 Well

Chicken Osteocalcin ELISA Kit

Sign In for Pricing
View Details
Chicken Osteocalcin ELISA Kit
MBS1603402-02 96 Well

Chicken Osteocalcin ELISA Kit

Sign In for Pricing
View Details
Chicken Osteocalcin ELISA Kit
MBS1603402-03 5x 96 Well

Chicken Osteocalcin ELISA Kit

Sign In for Pricing
View Details
Chicken Osteocalcin ELISA Kit
MBS1603402-04 10x 96 Well

Chicken Osteocalcin ELISA Kit

Sign In for Pricing
View Details