Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PACS1 Peptide - C-terminal region

PACS1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MRD17

UniProt

Q6VY07

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_060496.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LQVDYWLGHPGERRREGDKRDASSKNTLKSVFRSVQVSRLPHSGEAQLSG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PIN, FLOATING, TUBE, Stainless Steel, 6nL-Slot, 0.457mm Diameter, 17mm Exposed Length, 38.1mm Total Length
FP1NS6 1 EACH

PIN, FLOATING, TUBE, Stainless Steel, 6nL-Slot, 0.457mm Diameter, 17mm Exposed Length, 38.1mm Total Length

Sign In for Pricing
View Details
DTNBP1 (Dystrobrevin-binding Protein 1, Dysbindin, DBND, DKFZp564K192, FLJ30031, HPS7, MGC20210, My031, SD) (HRP)
MBS6414697-01 0.1 mL

DTNBP1 (Dystrobrevin-binding Protein 1, Dysbindin, DBND, DKFZp564K192, FLJ30031, HPS7, MGC20210, My031, SD) (HRP)

Sign In for Pricing
View Details
DTNBP1 (Dystrobrevin-binding Protein 1, Dysbindin, DBND, DKFZp564K192, FLJ30031, HPS7, MGC20210, My031, SD) (HRP)
MBS6414697-02 5x 0.1 mL

DTNBP1 (Dystrobrevin-binding Protein 1, Dysbindin, DBND, DKFZp564K192, FLJ30031, HPS7, MGC20210, My031, SD) (HRP)

Sign In for Pricing
View Details
HNRPAB Rabbit Polyclonal Antibody (FITC)
orb2125440 100 µL

HNRPAB Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Rab11-FIP4 Antibody
MBS8513214-01 0.05 mg

Rab11-FIP4 Antibody

Sign In for Pricing
View Details
Rab11-FIP4 Antibody
MBS8513214-02 0.1 mg

Rab11-FIP4 Antibody

Sign In for Pricing
View Details