What is the catalog number for DENND2D Peptide - middle region?

The catalog number for DENND2D Peptide - middle region is orb1997884.

What sizes are available for DENND2D Peptide - middle region?

DENND2D Peptide - middle region is available in the following size(s): 100 µg.

Is DENND2D Peptide - middle region in stock?

DENND2D Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

DENND2D Peptide - middle region

Product Specifications

UniProt

Q9H6A0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_079177.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KKKRSEDDYEPIITYQFPKRENLLRGQQEEEERLLKAIPLFCFPDGNEWA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MR225140L4 10 µg

Prkg2 (NM_008926) Mouse Tagged Lenti ORF Clone

Sign In for Pricing

View Details

K1466904 1.0 µg DNA

NUFIP1P sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing

View Details

NBP3-14204R 0.1 mL

Mouse Monoclonal ERG Antibody (rERG/6843) [DyLight 550]

Sign In for Pricing

View Details

ARP37592_P050-FITC 100 µL

Txlng Antibody - N-terminal region : FITC (ARP37592_P050-FITC)

Sign In for Pricing

View Details

MBS6466624-01 0.1 mL

Calcitonin (AP)

Sign In for Pricing

View Details

MBS6466624-02 5x 0.1 mL

Calcitonin (AP)

Sign In for Pricing

View Details