Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DENND2D Peptide - middle region

DENND2D Peptide - middle region

Product Specifications

UniProt

Q9H6A0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_079177.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KKKRSEDDYEPIITYQFPKRENLLRGQQEEEERLLKAIPLFCFPDGNEWA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Cystatin C
BITP1534 20 µg

Human Cystatin C

Sign In for Pricing
View Details
RAB3GAP1 Antibody - middle region
ARP79022_P050-25UL 25 µL

RAB3GAP1 Antibody - middle region

Sign In for Pricing
View Details
RACGAP1 Protein Vector (Rat) (pPM-C-HA)
PV297940 500 ng

RACGAP1 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
GLS sgRNA CRISPR Lentivector (Human) (Target 1)
K0868502 1.0 µg DNA

GLS sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Tert-Butyl 1,5-diazocane-1-carboxylate
OR93630-01 100 mg

Tert-Butyl 1,5-diazocane-1-carboxylate

Sign In for Pricing
View Details
Tert-Butyl 1,5-diazocane-1-carboxylate
OR93630-02 250 mg

Tert-Butyl 1,5-diazocane-1-carboxylate

Sign In for Pricing
View Details