Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DDX52 Peptide - N-terminal region

DDX52 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ROK1, HUSSY19

UniProt

Q9Y2R4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_008941.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SSEVLQGLDFFGNKKSVPGVCGASQTHQKPQNGEKKEESLTERKREQSKK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mesothelin (MSLN) (NM_005823) Human Recombinant Protein
TP723884 10 µg

Mesothelin (MSLN) (NM_005823) Human Recombinant Protein

Sign In for Pricing
View Details
Asic3 Mouse Gene Knockout Kit (CRISPR)
KN501680 1 Kit

Asic3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ravuconazole-d4
TRC-R128002-1MG 1 mg

Ravuconazole-d4

Sign In for Pricing
View Details
GOLGA6L6 Human Gene Knockout Kit (CRISPR)
KN426519 1 Kit

GOLGA6L6 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
AMPD2 Human Gene Knockout Kit (CRISPR)
KN402938 1 Kit

AMPD2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MAPT / TAU pSer404 Rabbit Polyclonal Antibody
AP01708PU-N 100 µg

MAPT / TAU pSer404 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details