Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CUTA Peptide - middle region

CUTA Peptide - middle region

Product Specifications

Product Name Alternative

AI326454, 0610039D01Rik, 1810022E02Rik, 1810060C03Rik, 2700094G22Rik

UniProt

Q9CQ89

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_080583.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ITSIYEWKGKIEEDSEVLMMIKTQSSLVPALTEFVRSVHPYEVAEVIALP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Battery
2020363/4 1 Each

Battery

Sign In for Pricing
View Details
GEMIN7 (gem (Nuclear organelle) Associated Protein 7, SIP3) (MaxLight 405) discontinued
246555-ML405 100 µL

GEMIN7 (gem (Nuclear organelle) Associated Protein 7, SIP3) (MaxLight 405) discontinued

Sign In for Pricing
View Details
CCBL1 (Kynurenine-oxoglutarate Transaminase 1, Cysteine-S-conjugate beta-lyase, Glutamine Transaminase K, GTK, Glutamine-phenylpyruvate Transaminase, Kynurenine Aminotransferase I, KATI, Kynurenine-oxoglutarate Transaminase I) (MaxLight 750) discontinued
124417-ML750 100 µL

CCBL1 (Kynurenine-oxoglutarate Transaminase 1, Cysteine-S-conjugate beta-lyase, Glutamine Transaminase K, GTK, Glutamine-phenylpyruvate Transaminase, Kynurenine Aminotransferase I, KATI, Kynurenine-oxoglutarate Transaminase I) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Lentiviral mouse Nap1l4 shRNA (UAS) - Lentiviral mouse Nap1l4 shRNA (UAS) (25)
GTR15165953 1 Vial

Lentiviral mouse Nap1l4 shRNA (UAS) - Lentiviral mouse Nap1l4 shRNA (UAS) (25)

Sign In for Pricing
View Details
Arachis hypogaea (PNA) (Magnetic Beads) discontinued
518205-01 1 mL

Arachis hypogaea (PNA) (Magnetic Beads) discontinued

Sign In for Pricing
View Details
Arachis hypogaea (PNA) (Magnetic Beads) discontinued
518205-02 5 mL

Arachis hypogaea (PNA) (Magnetic Beads) discontinued

Sign In for Pricing
View Details