Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RGR Peptide - middle region

RGR Peptide - middle region

Product Specifications

UniProt

Q9Z2B3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_067315.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PVNTTLPGRMLLLGWGPYALLYLYAAIADVSFISPKLQMVPALIAKTMPT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Cytomegaoviyns IgM Antibody ELISA Kit
MBS3802005-01 48 Well

Human Cytomegaoviyns IgM Antibody ELISA Kit

Sign In for Pricing
View Details
Human Cytomegaoviyns IgM Antibody ELISA Kit
MBS3802005-02 96 Well

Human Cytomegaoviyns IgM Antibody ELISA Kit

Sign In for Pricing
View Details
Human Cytomegaoviyns IgM Antibody ELISA Kit
MBS3802005-03 5x 96 Well

Human Cytomegaoviyns IgM Antibody ELISA Kit

Sign In for Pricing
View Details
Human Cytomegaoviyns IgM Antibody ELISA Kit
MBS3802005-04 10x 96 Well

Human Cytomegaoviyns IgM Antibody ELISA Kit

Sign In for Pricing
View Details
MNDA Antibody
MBS856349-01 0.1 mg

MNDA Antibody

Sign In for Pricing
View Details
MNDA Antibody
MBS856349-02 0.1 mL (AF635)

MNDA Antibody

Sign In for Pricing
View Details