What is the catalog number for RGR Peptide - middle region?

The catalog number for RGR Peptide - middle region is orb1997878.

What sizes are available for RGR Peptide - middle region?

RGR Peptide - middle region is available in the following size(s): 100 µg.

Is RGR Peptide - middle region in stock?

RGR Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

RGR Peptide - middle region

Product Specifications

UniProt

Q9Z2B3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_067315.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PVNTTLPGRMLLLGWGPYALLYLYAAIADVSFISPKLQMVPALIAKTMPT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

E43S48349 100 µL

Syntenin Recombinant Rabbit mAb

Sign In for Pricing

View Details

NBP1-42665AF647 0.1 mL

Rabbit Polyclonal Pygopus-1 Antibody [Alexa Fluor 647]

Sign In for Pricing

View Details

E-AB-66033-01 60 µL

DUSP12 Polyclonal Antibody

Sign In for Pricing

View Details

E-AB-66033-02 120 µL

DUSP12 Polyclonal Antibody

Sign In for Pricing

View Details

E-AB-66033-03 200 µL

DUSP12 Polyclonal Antibody

Sign In for Pricing

View Details

MBS2081243-01 0.1 mL

Cy3-Linked Polyclonal Antibody to Cartilage Associated Protein (CRTAP)

Sign In for Pricing

View Details