Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

H2AFX Peptide - N-terminal region

H2AFX Peptide - N-terminal region

Product Specifications

Product Name Alternative

H2ax, H2A.X, AW228881, Hist5-2ax, gammaH2ax

UniProt

P27661

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_034566.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DNA PKcs Recombinant Rabbit monoclonal Antibody
HA750198 100 µL

DNA PKcs Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
LPCAT3 (NM_005768) Human Over-expression Lysate
LC401759 20 µg

LPCAT3 (NM_005768) Human Over-expression Lysate

Sign In for Pricing
View Details
CD4 (EDU-2), Biotin conjugate, 0.1mg/mL
BNCB0345-100 1x 100 µL

CD4 (EDU-2), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NKIRAS2 (NM_001001349) Human Recombinant Protein
TP323273 20 µg

NKIRAS2 (NM_001001349) Human Recombinant Protein

Sign In for Pricing
View Details
Creld2 Mouse Gene Knockout Kit (CRISPR)
KN503819 1 Kit

Creld2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
IRF5 Polyclonal Antibody
E-AB-19512-01 20 µL

IRF5 Polyclonal Antibody

Sign In for Pricing
View Details