Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

H2AFX Peptide - N-terminal region

H2AFX Peptide - N-terminal region

Product Specifications

Product Name Alternative

H2ax, H2A.X, AW228881, Hist5-2ax, gammaH2ax

UniProt

P27661

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_034566.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tripropylene Glycol Diacrylate, Mixture of Isomers
TRC-T814015-25G 25 g

Tripropylene Glycol Diacrylate, Mixture of Isomers

Sign In for Pricing
View Details
Histone H1 (Nuclear Marker) (HH1/1784R), CF640R conjugate, 0.1mg/mL
BNC401784-500 1x 500 µL

Histone H1 (Nuclear Marker) (HH1/1784R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PE/Elab Fluor® 594 Anti-Mouse CD170 Antibody[S17007L]
AN00629P-01 50 Tests

PE/Elab Fluor® 594 Anti-Mouse CD170 Antibody[S17007L]

Sign In for Pricing
View Details
PE/Elab Fluor® 594 Anti-Mouse CD170 Antibody[S17007L]
AN00629P-02 100 Tests

PE/Elab Fluor® 594 Anti-Mouse CD170 Antibody[S17007L]

Sign In for Pricing
View Details
PE/Elab Fluor® 594 Anti-Mouse CD170 Antibody[S17007L]
AN00629P-03 2x 100 Tests

PE/Elab Fluor® 594 Anti-Mouse CD170 Antibody[S17007L]

Sign In for Pricing
View Details
HER-2 / c-erbB-2 / neu / CD340 (ERBB2/3079), CF568 conjugate, 0.1mg/mL
BNC683079-100 1x 100 µL

HER-2 / c-erbB-2 / neu / CD340 (ERBB2/3079), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details