MSRA Peptide - middle region
MSRA Peptide - middle region
Product Specifications
Product Name Alternative
MSR-A, 2310045J23Rik, 6530413P12Rik
UniProt
Q9D6Y7
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001240641.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: KVFWENHDPTQGMRQGNDFGTQYRSAVYPTSAVQMEAALRSKEEYQKVLS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS729776-03 5x 96 Well
Rabbit Ferritin Light Polypeptide ELISA Kit
Sign In for Pricing
View Details MBS729776-04 10x 96 Well
Rabbit Ferritin Light Polypeptide ELISA Kit
Sign In for Pricing
View Details