Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MSRA Peptide - middle region

MSRA Peptide - middle region

Product Specifications

Product Name Alternative

MSR-A, 2310045J23Rik, 6530413P12Rik

UniProt

Q9D6Y7

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001240641.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KVFWENHDPTQGMRQGNDFGTQYRSAVYPTSAVQMEAALRSKEEYQKVLS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EphB3 siRNA (m2)
sc-270323 10 µM

EphB3 siRNA (m2)

Sign In for Pricing
View Details
Tmk Antibody
orb820071 2 mg

Tmk Antibody

Sign In for Pricing
View Details
Recombinant Human Activin RIIB
BL10285_R 0.1 mg

Recombinant Human Activin RIIB

Sign In for Pricing
View Details
CNTF, His Active
cyt-909-01 5µg

CNTF, His Active

Sign In for Pricing
View Details
CNTF, His Active
cyt-909-02 20µg

CNTF, His Active

Sign In for Pricing
View Details
CNTF, His Active
cyt-909-03 1mg

CNTF, His Active

Sign In for Pricing
View Details