Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD151 Peptide - middle region

CD151 Peptide - middle region

Product Specifications

Product Name Alternative

SFA-1, PETA-3, Tspan24

UniProt

O35566

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001104519.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LIIFLLEIIAGILAYVYYQQLNTELKENLKDTMVKRYHQSGHEGVSSAVD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MTF-2 shRNA Plasmid (h)
sc-88160-SH 20 µg

MTF-2 shRNA Plasmid (h)

Sign In for Pricing
View Details
NHLH1 Rabbit pAb, BF700 conjugated
orb2857790 100 µL

NHLH1 Rabbit pAb, BF700 conjugated

Sign In for Pricing
View Details
Clofarabine 5'-triphosphate triethylammonium salt
NC15333-01 1 mg

Clofarabine 5'-triphosphate triethylammonium salt

Sign In for Pricing
View Details
Clofarabine 5'-triphosphate triethylammonium salt
NC15333-02 2 mg

Clofarabine 5'-triphosphate triethylammonium salt

Sign In for Pricing
View Details
Clofarabine 5'-triphosphate triethylammonium salt
NC15333-03 5 mg

Clofarabine 5'-triphosphate triethylammonium salt

Sign In for Pricing
View Details
Clofarabine 5'-triphosphate triethylammonium salt
NC15333-04 10 mg

Clofarabine 5'-triphosphate triethylammonium salt

Sign In for Pricing
View Details