CD151 Peptide - middle region
CD151 Peptide - middle region
Product Specifications
Product Name Alternative
SFA-1, PETA-3, Tspan24
UniProt
O35566
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001104519.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LIIFLLEIIAGILAYVYYQQLNTELKENLKDTMVKRYHQSGHEGVSSAVD
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1481659 Inquire
Recombinant Syntrophomonas wolfei subsp. wolfei DNA mismatch repair protein mutL (mutL), partial
Sign In for Pricing
View Details 
bs-12325R-Cy5.5 100 µL
PTCHD3 Polyclonal Antibody, Cy5.5 Conjugated
Sign In for Pricing
View Details 
GTR15262926 1 Vial
Lentiviral mouse Zfp521 shRNA (UAS) - Lentiviral mouse Zfp521 shRNA (UAS) (100)
Sign In for Pricing
View Details