Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KLF6 Peptide - middle region

KLF6 Peptide - middle region

Product Specifications

Product Name Alternative

FM2, FM6, Zf9, BCD1, CPBP, Copeb, C86813, R75280, Ierepo1, Ierepo3, AI448727

UniProt

O08584

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LKISSSPPEDSLISSSFNYNLETNSLNSDVSSESSDSSEELSPTTKFTSD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FGF acidic
M10-045-L100 100 µg

FGF acidic

Sign In for Pricing
View Details
ACAA1 Polyclonal Antibody
E914700 100 µL

ACAA1 Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human TIM4 (His-Tag)
P4303-10μg 10 µg

Recombinant Human TIM4 (His-Tag)

Sign In for Pricing
View Details
FBXO5 Antibody Blocking peptide
orb1454491 500 µg

FBXO5 Antibody Blocking peptide

Sign In for Pricing
View Details
ACSL1 (NM_001286711) Human Untagged Clone
SC337149 10 µg

ACSL1 (NM_001286711) Human Untagged Clone

Sign In for Pricing
View Details
Mouse Dio2 qPCR Primer Pair
QM12130S 200 Tests

Mouse Dio2 qPCR Primer Pair

Sign In for Pricing
View Details