Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARG2 Peptide - middle region

ARG2 Peptide - middle region

Product Specifications

Product Name Alternative

AII, AU022422

UniProt

O08691

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_033835.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DAHADINTPLTTVSGNIHGQPLSFLIKELQDKVPQLPGFSWIKPCLSPPN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-human Intestinal-type alkaline phosphatase polyclonal Antibody, FITC
MBS719595-01 0.05 mg

Rabbit anti-human Intestinal-type alkaline phosphatase polyclonal Antibody, FITC

Sign In for Pricing
View Details
Rabbit anti-human Intestinal-type alkaline phosphatase polyclonal Antibody, FITC
MBS719595-02 0.1 mg

Rabbit anti-human Intestinal-type alkaline phosphatase polyclonal Antibody, FITC

Sign In for Pricing
View Details
Rabbit anti-human Intestinal-type alkaline phosphatase polyclonal Antibody, FITC
MBS719595-03 5x 0.1 mg

Rabbit anti-human Intestinal-type alkaline phosphatase polyclonal Antibody, FITC

Sign In for Pricing
View Details
Anti-TMEM74 Antibody
MBS8308433-01 0.03 mL

Anti-TMEM74 Antibody

Sign In for Pricing
View Details
Anti-TMEM74 Antibody
MBS8308433-02 0.05 mL

Anti-TMEM74 Antibody

Sign In for Pricing
View Details
Anti-TMEM74 Antibody
MBS8308433-03 0.1 mL

Anti-TMEM74 Antibody

Sign In for Pricing
View Details