Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARG2 Peptide - middle region

ARG2 Peptide - middle region

Product Specifications

Product Name Alternative

AII, AU022422

UniProt

O08691

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_033835.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DAHADINTPLTTVSGNIHGQPLSFLIKELQDKVPQLPGFSWIKPCLSPPN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monoallyl Phthalate
165023 100 mg

Monoallyl Phthalate

Sign In for Pricing
View Details
Zfp948 Protein Vector (Mouse) (pPB-N-His)
PV250563 500 ng

Zfp948 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Recombinant Aspergillus oryzae Palmitoyltransferase akr1 (akr1)
MBS7007620-01 0.02 mg

Recombinant Aspergillus oryzae Palmitoyltransferase akr1 (akr1)

Sign In for Pricing
View Details
Recombinant Aspergillus oryzae Palmitoyltransferase akr1 (akr1)
MBS7007620-02 0.1 mg

Recombinant Aspergillus oryzae Palmitoyltransferase akr1 (akr1)

Sign In for Pricing
View Details
Recombinant Aspergillus oryzae Palmitoyltransferase akr1 (akr1)
MBS7007620-03 5x 0.1 mg

Recombinant Aspergillus oryzae Palmitoyltransferase akr1 (akr1)

Sign In for Pricing
View Details
BeyoFastTM SacI
D5865-100μl 100 µL

BeyoFastTM SacI

Sign In for Pricing
View Details