Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CAP1 Peptide - middle region

CAP1 Peptide - middle region

Product Specifications

UniProt

P40124

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001287996.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ITHALKHVSDDMKTHKNPALKAQSGPVRSGPKPFSAPKPQTSPSPKPATK

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCDH12 (NM_016580) Human Recombinant Protein
TP323041 20 µg

PCDH12 (NM_016580) Human Recombinant Protein

Sign In for Pricing
View Details
Rabbit Polyclonal E74 like factor 1 Antibody
NBP3-10893-100ul 100 µL

Rabbit Polyclonal E74 like factor 1 Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human p38 Polyclonal Antibody
PA83248HU-01 50 µg

Rabbit Anti-Human p38 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human p38 Polyclonal Antibody
PA83248HU-02 100 µg

Rabbit Anti-Human p38 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human p38 Polyclonal Antibody
PA83248HU-03 500 µg

Rabbit Anti-Human p38 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human p38 Polyclonal Antibody
PA83248HU-04 1 mg

Rabbit Anti-Human p38 Polyclonal Antibody

Sign In for Pricing
View Details