Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CAP1 Peptide - middle region

CAP1 Peptide - middle region

Product Specifications

UniProt

P40124

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001287996.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ITHALKHVSDDMKTHKNPALKAQSGPVRSGPKPFSAPKPQTSPSPKPATK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TULP4 Human Over-expression Lysate
orb1362775 20 µg

TULP4 Human Over-expression Lysate

Sign In for Pricing
View Details
SCTR Antibody, FITC conjugated
CSB-PA020865LC01HU-01 50 µg

SCTR Antibody, FITC conjugated

Sign In for Pricing
View Details
SCTR Antibody, FITC conjugated
CSB-PA020865LC01HU-02 100 µg

SCTR Antibody, FITC conjugated

Sign In for Pricing
View Details
CIDEB Antibody
34263-01 50 µL

CIDEB Antibody

Sign In for Pricing
View Details
CIDEB Antibody
34263-02 100 µL

CIDEB Antibody

Sign In for Pricing
View Details
CHST12 (Carbohydrate Sulfotransferase 12, Chondroitin 4-O-Sulfotransferase 2, Chondroitin 4-Sulfotransferase 2, C4ST-2, C4ST2, Sulfotransferase Hlo, CHST12) (MaxLight 490) discontinued
302354-ML490 100 µL

CHST12 (Carbohydrate Sulfotransferase 12, Chondroitin 4-O-Sulfotransferase 2, Chondroitin 4-Sulfotransferase 2, C4ST-2, C4ST2, Sulfotransferase Hlo, CHST12) (MaxLight 490) discontinued

Sign In for Pricing
View Details