Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GSN Peptide - middle region

GSN Peptide - middle region

Product Specifications

Product Name Alternative

ADF

UniProt

P13020

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_666232.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ALKTASDFISKMQYPRQTQVSVLPEGGETPLFKQFFKNWRDPDQTDGPGL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glyphosate
TRC-G765000-250MG 250 mg

Glyphosate

Sign In for Pricing
View Details
Cycloguanil-d4 Hydrochloride
TRC-C987882-1MG 1 mg

Cycloguanil-d4 Hydrochloride

Sign In for Pricing
View Details
ROR1 Human Gene Knockout Kit (CRISPR)
KN214967RB 1 Kit

ROR1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
UBXD5 (UBXN11) (NM_001077262) Human Recombinant Protein
TP324331 20 µg

UBXD5 (UBXN11) (NM_001077262) Human Recombinant Protein

Sign In for Pricing
View Details
CD45 / LCA (B-Cell Marker) (rPTPRC/1460), CF488A conjugate, 0.1mg/mL
BNC882066-100 1x 100 µL

CD45 / LCA (B-Cell Marker) (rPTPRC/1460), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Amylocaine Hydrochloride
TRC-A636700-25MG 25 mg

Amylocaine Hydrochloride

Sign In for Pricing
View Details