CHRNA5 Peptide - middle region
CHRNA5 Peptide - middle region
Product Specifications
Product Name Alternative
Acra5, Acra-5
UniProt
Q2MKA5
Field of Research
Neuroscience
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_789814.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: KIKFGLAISQLVDVDEKNQLMTTNVWLKQEWIDVKLRWNPDDYGGIKIIR
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
D95458B 1x 10 L R1, 1x 2.5 L R2
Uric Acid TBHBA, Enzymatic, colorimetric
Sign In for Pricing
View Details 
MBS6432672-01 0.1 mL
PPP2R3A (Serine/Threonine-protein Phosphatase 2A Regulatory Subunit B'' Subunit alpha, PR72, PR130, PPP2R3) (MaxLight 405)
Sign In for Pricing
View Details MBS6432672-02 5x 0.1 mL
PPP2R3A (Serine/Threonine-protein Phosphatase 2A Regulatory Subunit B'' Subunit alpha, PR72, PR130, PPP2R3) (MaxLight 405)
Sign In for Pricing
View Details NBP2-71076AF350 0.1 mL
Mouse Monoclonal CD117/c-kit Antibody (OTI2B12) [Alexa Fluor 350]
Sign In for Pricing
View Details