Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHRNA5 Peptide - middle region

CHRNA5 Peptide - middle region

Product Specifications

Product Name Alternative

Acra5, Acra-5

UniProt

Q2MKA5

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_789814.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KIKFGLAISQLVDVDEKNQLMTTNVWLKQEWIDVKLRWNPDDYGGIKIIR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Herpes Virus Type 6, Human, B Variant (HHV) (MaxLight 405) discontinued
H2034-01W-ML405 100 µL

Herpes Virus Type 6, Human, B Variant (HHV) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Macrophage Inflammatory Protein 1 Beta (MIP1b) BioAssayTM ELISA Kit (Chicken)
026631 96 Tests

Macrophage Inflammatory Protein 1 Beta (MIP1b) BioAssayTM ELISA Kit (Chicken)

Sign In for Pricing
View Details
Goat Vimentin ELISA Kit
MBS739793-01 48 Well

Goat Vimentin ELISA Kit

Sign In for Pricing
View Details
Goat Vimentin ELISA Kit
MBS739793-02 96 Well

Goat Vimentin ELISA Kit

Sign In for Pricing
View Details
Goat Vimentin ELISA Kit
MBS739793-03 5x 96 Well

Goat Vimentin ELISA Kit

Sign In for Pricing
View Details
Goat Vimentin ELISA Kit
MBS739793-04 10x 96 Well

Goat Vimentin ELISA Kit

Sign In for Pricing
View Details