What is the catalog number for ELF3 Peptide - middle region?

The catalog number for ELF3 Peptide - middle region is orb1997864.

What sizes are available for ELF3 Peptide - middle region?

ELF3 Peptide - middle region is available in the following size(s): 100 µg.

Is ELF3 Peptide - middle region in stock?

ELF3 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

ELF3 Peptide - middle region

Product Specifications

Product Name Alternative

ESX, jen, ESE-1

UniProt

Q3UPW2

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001156603.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QSSHASDSGGSDVDLDLTESKVFPRDGFPDYKKGEPKHGKRKRGRPRKLS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NBP2-99450MFV500 0.1 mL

Rabbit Polyclonal MIA Antibody [mFluor Violet 500 SE]

Sign In for Pricing

View Details

MBS7142523 Inquire

Rabbit anti-Drosophila melanogaster (Fruit fly) lds Polyclonal Antibody

Sign In for Pricing

View Details

orb1317372-01 30 µL

SETD2 Antibody

Sign In for Pricing

View Details

orb1317372-02 50 μL

SETD2 Antibody

Sign In for Pricing

View Details

orb1317372-03 100 µL

SETD2 Antibody

Sign In for Pricing

View Details

EK12F733-01 48 Test

Porcine Alpha-Lactalbumin (LALBA) ELISA Kit-Sandwich

Sign In for Pricing

View Details