Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TYRP1 Peptide - middle region

TYRP1 Peptide - middle region

Product Specifications

Product Name Alternative

B, isa, Oca3, TRP1, Tyrp, TRP-1, brown

UniProt

P07147

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001268943.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EGYSAPTGKYDPAVRSLHNLAHLFLNGTGGQTHLSPNDPIFVLLHTFTDA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human BICC1 shRNA (UAS) - Lentiviral human BICC1 shRNA (UAS, GFP) plasmid
GTR15340609 1 Vial

Lentiviral human BICC1 shRNA (UAS) - Lentiviral human BICC1 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Cellular Senescence Detection Kit (SA-β-Gal Staining)
CBA-230 50 Assays

Cellular Senescence Detection Kit (SA-β-Gal Staining)

Sign In for Pricing
View Details
Ribophorin II (RPN2) (NM_002951) Human Recombinant Protein
TP305852M 100 µg

Ribophorin II (RPN2) (NM_002951) Human Recombinant Protein

Sign In for Pricing
View Details
EPPIN Conjugated Antibody
C37552 100 µL

EPPIN Conjugated Antibody

Sign In for Pricing
View Details
Tert-Butyl 2- ((2-chloroacetamido) methyl) piperidine-1-carboxylate
OR1050416-01 100 mg

Tert-Butyl 2- ((2-chloroacetamido) methyl) piperidine-1-carboxylate

Sign In for Pricing
View Details
Tert-Butyl 2- ((2-chloroacetamido) methyl) piperidine-1-carboxylate
OR1050416-02 250 mg

Tert-Butyl 2- ((2-chloroacetamido) methyl) piperidine-1-carboxylate

Sign In for Pricing
View Details