Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TYRP1 Peptide - middle region

TYRP1 Peptide - middle region

Product Specifications

Product Name Alternative

B, isa, Oca3, TRP1, Tyrp, TRP-1, brown

UniProt

P07147

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001268943.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EGYSAPTGKYDPAVRSLHNLAHLFLNGTGGQTHLSPNDPIFVLLHTFTDA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MA2 Double Nickase Plasmid (h2)
sc-407564-NIC-2 20 µg

MA2 Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
pT7-6×His-GRB2 Plasmid
PVT47274 2 µg

pT7-6×His-GRB2 Plasmid

Sign In for Pricing
View Details
PIBF1 Antibody, HRP conjugated
A77131-100UL 100 µL

PIBF1 Antibody, HRP conjugated

Sign In for Pricing
View Details
pCMV-SPORT6-Carkd Plasmid
PVT43842 2 µg

pCMV-SPORT6-Carkd Plasmid

Sign In for Pricing
View Details
Recombinant Human PI4KA Protein, N-GST
HW485012-01 50 µg

Recombinant Human PI4KA Protein, N-GST

Sign In for Pricing
View Details
Recombinant Human PI4KA Protein, N-GST
HW485012-02 100 µg

Recombinant Human PI4KA Protein, N-GST

Sign In for Pricing
View Details