DDX58 Peptide - middle region
DDX58 Peptide - middle region
Product Specifications
Product Name Alternative
RIG-I, RLR-1, C330021E21, 6430573D20Rik
UniProt
Q6Q899
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_766277.3
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ASRTSNTFKCIISQLMKETEKLAKDVSEELGKLFQIQNREFGTQKYEQWI
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR10369926 96 Well
Canine Tryptophan 5 hydroxylase 1 (TPH1) ELISA Kit
Sign In for Pricing
View Details 
124032 50 µg
BTBD9 (KIAA1880, BTB/POZ Domain-containing Protein 9, FLJ32945, MGC120517, MGC120519, MGC120520)
Sign In for Pricing
View Details 32445126 3x 1.0µg DNA
ODF3B CRISPRa sgRNA lentivector (set of three targets)(Rat)
Sign In for Pricing
View Details