Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DDX58 Peptide - middle region

DDX58 Peptide - middle region

Product Specifications

Product Name Alternative

RIG-I, RLR-1, C330021E21, 6430573D20Rik

UniProt

Q6Q899

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_766277.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ASRTSNTFKCIISQLMKETEKLAKDVSEELGKLFQIQNREFGTQKYEQWI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MMP3 Conjugated Antibody
MBS9443370-01 0.1 mL (Biotin)

MMP3 Conjugated Antibody

Sign In for Pricing
View Details
MMP3 Conjugated Antibody
MBS9443370-02 0.1 mL (AF350)

MMP3 Conjugated Antibody

Sign In for Pricing
View Details
MMP3 Conjugated Antibody
MBS9443370-03 0.1 mL (AF405)

MMP3 Conjugated Antibody

Sign In for Pricing
View Details
MMP3 Conjugated Antibody
MBS9443370-04 0.1 mL (AF488)

MMP3 Conjugated Antibody

Sign In for Pricing
View Details
MMP3 Conjugated Antibody
MBS9443370-05 0.1 mL (AF555)

MMP3 Conjugated Antibody

Sign In for Pricing
View Details
MMP3 Conjugated Antibody
MBS9443370-06 0.1 mL (AF594)

MMP3 Conjugated Antibody

Sign In for Pricing
View Details