Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AIP Peptide - middle region

AIP Peptide - middle region

Product Specifications

Product Name Alternative

Ara9, Xap2, Fkbp16, AA408703, AW476050, D19Bwg1412e

UniProt

O08915

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001263213.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DHCSSILNKYDDNVKAYFKRGKAHAAVWNAQEAQADFAKVLELDPALAPV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GAL Rabbit Polyclonal Antibody (APC-Cy5.5)
orb2560400 100 µL

GAL Rabbit Polyclonal Antibody (APC-Cy5.5)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Interleukin 1 Receptor Like Protein 1 (IL1RL1)
MBS2080447-01 0.1 mL

FITC-Linked Polyclonal Antibody to Interleukin 1 Receptor Like Protein 1 (IL1RL1)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Interleukin 1 Receptor Like Protein 1 (IL1RL1)
MBS2080447-02 0.2 mL

FITC-Linked Polyclonal Antibody to Interleukin 1 Receptor Like Protein 1 (IL1RL1)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Interleukin 1 Receptor Like Protein 1 (IL1RL1)
MBS2080447-03 0.5 mL

FITC-Linked Polyclonal Antibody to Interleukin 1 Receptor Like Protein 1 (IL1RL1)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Interleukin 1 Receptor Like Protein 1 (IL1RL1)
MBS2080447-04 1 mL

FITC-Linked Polyclonal Antibody to Interleukin 1 Receptor Like Protein 1 (IL1RL1)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Interleukin 1 Receptor Like Protein 1 (IL1RL1)
MBS2080447-05 5 mL

FITC-Linked Polyclonal Antibody to Interleukin 1 Receptor Like Protein 1 (IL1RL1)

Sign In for Pricing
View Details