AIP Peptide - middle region
AIP Peptide - middle region
Product Specifications
Product Name Alternative
Ara9, Xap2, Fkbp16, AA408703, AW476050, D19Bwg1412e
UniProt
O08915
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001263213.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: DHCSSILNKYDDNVKAYFKRGKAHAAVWNAQEAQADFAKVLELDPALAPV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS623222-01 0.1 mL
Superoxide Dismutase, Cu,Zn (Superoxide Dismutase Cu/Zn, SOD Cu,Zn, Cu/Zn SOD, Amyotrophic Lateral Sclerosis 1, ALS1, ALS, Homodimer, Indophenoloxidase A, IPOA, Superoxide Dismutase 1, Superoxide Dismutase 1 Soluble, SOD1, SOD-1, Superoxide Dismutase Cyst
Sign In for Pricing
View Details MBS623222-02 5x 0.1 mL
Superoxide Dismutase, Cu,Zn (Superoxide Dismutase Cu/Zn, SOD Cu,Zn, Cu/Zn SOD, Amyotrophic Lateral Sclerosis 1, ALS1, ALS, Homodimer, Indophenoloxidase A, IPOA, Superoxide Dismutase 1, Superoxide Dismutase 1 Soluble, SOD1, SOD-1, Superoxide Dismutase Cyst
Sign In for Pricing
View Details 