Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDC20 Peptide - N-terminal region

CDC20 Peptide - N-terminal region

Product Specifications

Product Name Alternative

C87100, p55CDC, 2310042N09Rik

UniProt

Q9JJ66

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_075712.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KEATGPAPSPMRAANRSHSAGRTPGRTPGKSSSKVQTTPSKPGGDRFIPQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Cecum
CS506126 5x 5 µm

Frozen Tissue Sections, Cecum

Sign In for Pricing
View Details
2X One-Step RT-PCR Master Mix-500p
28115 500 Reactions

2X One-Step RT-PCR Master Mix-500p

Sign In for Pricing
View Details
TAQuest™ qPCR Master Mix for TaqMan Probes *Low ROX*
17284-AAT 1 mL

TAQuest™ qPCR Master Mix for TaqMan Probes *Low ROX*

Sign In for Pricing
View Details
Cldn4 (NM_009903) Mouse Recombinant Protein
TP524818 20 µg

Cldn4 (NM_009903) Mouse Recombinant Protein

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon: right
CS630436 5x 5 µm

Frozen Tissue Sections, Colon: right

Sign In for Pricing
View Details
CD63 (LAMP3/968), 0.2mg/mL
BNUB0968-100 1x 100 µL

CD63 (LAMP3/968), 0.2mg/mL

Sign In for Pricing
View Details